PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07228A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 248aa    MW: 25590.2 Da    PI: 7.7667
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07228AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.72.3e-44281271100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq
  Oropetium_20150105_07228A  28 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQ 111
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                +q+++l++el+++++e
  Oropetium_20150105_07228A 112 RQVHRLQKELDAAHAE 127
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3927128IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4328125IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MASPSSTSNS TLSPVAAPGT TTPGAGAPCA ACKFLRRKCL PGCVFAPYFP PEEPQKFANV  60
HKVFGASNVT KLLNELLPHQ REDAVSSLAY EAEARVKDPV YGCVGAISVL QRQVHRLQKE  120
LDAAHAELLR YACGDVGIPT ALPVSAAPRL STAMPSPGQL SAATAAAGMY SSRRLGVIDG  180
IAPPPPPPGC YFMRNNVISS PVADVAPVLP YASMANWAVN AISATTTTTS GSESIGIDHK  240
EGGDSSM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9516390.0JQ951639.1 Loudetia sp. MCE-2012 Ramosa2 (ra2) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968335.11e-150PREDICTED: LOB domain-containing protein 4-like
TrEMBLA0A0A9DMU91e-156A0A0A9DMU9_ARUDO; Uncharacterized protein
STRINGSi002632m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-63LBD family protein